PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.9G443300.1.p
Common NameSETIT_037280mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family LBD
Protein Properties Length: 242aa    MW: 25811.9 Da    PI: 7.0997
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.9G443300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260128.43.3e-40641631100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrr+Ca++Cvlapyfp ++p+kf  +h++FGasn++kll++lpe  r da+ss+vyeAear+rdPvyG++g + +lq+q ++lk
  Seita.9G443300.1.p  64 PCAACKILRRRCADGCVLAPYFPPAEPAKFTTAHRVFGASNIIKLLQDLPECSRADAVSSMVYEAEARLRDPVYGCAGAVCRLQRQANELK 154
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         ++la++++ 
  Seita.9G443300.1.p 155 VQLARAQAD 163
                         ****99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.24663164IPR004883Lateral organ boundaries, LOB
PfamPF031952.3E-4064161IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MDRSVMDYGS NASTGTTAAA AQQQQQYNNS CRSASPPSRV SSCSPPPPAA QVVGNAAPTV  60
VLSPCAACKI LRRRCADGCV LAPYFPPAEP AKFTTAHRVF GASNIIKLLQ DLPECSRADA  120
VSSMVYEAEA RLRDPVYGCA GAVCRLQRQA NELKVQLARA QADLLNAQAQ HANLLALVCV  180
DMVNRRDGHH QHQQLQQQPS SPLMDGGSGG GSNFGAAYHQ TFYDSDLDSA TWPDHEAQLW  240
T*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9539371e-139EU953937.1 Zea mays clone 1449845 LOB domain protein 11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004987050.21e-179PREDICTED: LOB domain-containing protein 1
TrEMBLK4AEH31e-175K4AEH3_SETIT; Uncharacterized protein
STRINGSi037280m1e-174(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26453790
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.11e-53LOB domain-containing protein 1